FAM117A Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAM117A. |
Modifications | Unmodified |
FAM117A Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAM117A. |
Modifications | Unmodified |
Rabbit Polyclonal Anti-FAM117A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM117A. Synthetic peptide located within the following region: SPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNP |
Rabbit Polyclonal Anti-FAM117A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM117A. Synthetic peptide located within the following region: SWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASP |