Rabbit Polyclonal Anti-FAM220A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM220A Antibody is: synthetic peptide directed towards the middle region of Human FAM220A. Synthetic peptide located within the following region: ATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPK |
FAM220A Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SIPAR |
FAM220A Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SIPAR |
Germany
Japan
United Kingdom
China