Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-EYA1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDPTAEYSTIHSP, from the internal region of the protein sequence according to NP_742057.1; NP_000494.2; NP_742056.1. |
EYA1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human EYA1 (NP_742055.1). |
| Modifications | Unmodified |
EYA1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EYA1. |
Rabbit Polyclonal Anti-CYP2A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI |
EYA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human EYA1 |
Eya1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- EYA1