Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to EPS8 (epidermal growth factor receptor pathway substrate 8)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Xenopus, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 761 and 822 of EPS8 (Uniprot ID#Q12929) |
Goat Anti-EPS8 Antibody
| Applications | IHC |
| Reactivities | Expected from sequence similarity: Human, Mouse, Rat, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SGVESFDEGSSH, from the C Terminus of the protein sequence according to NP_004438.3. |
Rabbit Polyclonal Anti-EPS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8 antibody: synthetic peptide directed towards the middle region of human EPS8. Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH |
Rabbit Polyclonal Anti-Eps8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Eps8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eps8. Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH |
EPS8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human EPS8 (NP_004438.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPS8