Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN |
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR |
ENO3 sheep polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Enolase isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
ENO3 sheep polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Biotin |
| Immunogen | Enolase isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure |
ENO3 sheep polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Enolase isolated and purified from Rabbit muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-b-Enolase(ENO-3) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-b-Enolase(ENO-3) Antibody: Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human b-Enolase(ENO-3). |
ENO3 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ENO3 |
ENO3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human ENO3 (NP_001967.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ENO3