Antibodies

View as table Download

Enkephalin (PENK) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Birds, Mammalian
Conjugation Unconjugated
Immunogen Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Enkephalin (PENK) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated
Immunogen Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde.

Goat Polyclonal Antibody against PENK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSHHQDGSDNEE, from the internal region of the protein sequence according to NP_006202.1.
TA303308 is a possible alternative to AM01180PU-N.

Rabbit Polyclonal Anti-PENK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG