Antibodies

Jump to Filters
View as table Download
EAF2 Rabbit Polyclonal Antibody
TA338035

USD 539.00

5 Days

Rabbit Polyclonal Anti-EAF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD
EAF2 Rabbit Polyclonal Antibody
TA375689

USD 365.00

3 Weeks

EAF2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human EAF2 (NP_060926.2).
Modifications Unmodified