Antibodies

View as table Download

Goat Polyclonal Antibody against DYX1C1

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIRNVIQGTELKS, from the C Terminus of the protein sequence according to NP_570722.2.
This antibody is expected to recognise only one of the three reported isoforms (NP_570722.2, isoform a).

Goat Anti-DYX1C1 / EKN1 Antibody

Applications PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence PLQVSDYSWQQTKT-C, from the N Terminus of the protein sequence according to NP_570722.2; NP_001028731.1; NP_001028732.1.

Rabbit Polyclonal Anti-DYX1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the C terminal of human DYX1C1. Synthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA

Rabbit Polyclonal Anti-DYX1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the middle region of human DYX1C1. Synthetic peptide located within the following region: TDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEK