Antibodies

View as table Download

Goat Polyclonal Antibody against DKK1

Applications FC, IF, IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374.

DKK1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Canine, Equine, Goat, Monkey, Mouse, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human DKK1 (NP_036374.1)

Rabbit Polyclonal Anti-DKK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Rabbit Polyclonal Anti-DKK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

USD 580.00

5 Weeks

Anti-DKK1 Reference Antibody (BHQ-880)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human, Mouse, Cynomolgus
Conjugation Unconjugated

USD 580.00

5 Weeks

Anti-DKK1 Reference Antibody (BHQ880)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human
Conjugation Unconjugated

DKK1 mouse monoclonal antibody, clone 2H2, Ascites

Applications WB
Reactivities Human
Conjugation Unconjugated

DKK1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 64~93 amino acids from the N-terminal region of Human Dickkopf-1.

Rabbit Polyclonal Anti-DKK1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen DKK1 antibody was raised against synthetic 15 amino acid peptide from 1st cytoplasmic domain of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%).

DKK1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 71-266 of human DKK1 (NP_036374.1).
Modifications Unmodified

Anti-DKK1 antibody(DM210), Rabbit mAb

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated