Antibodies

Jump to Filters
View as table Download
DNAJC25 Rabbit Polyclonal Antibody
TA336081

USD 539.00

5 Days

Rabbit Polyclonal Anti-DNAJC25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNAJC25 Antibody: synthetic peptide directed towards the middle region of human DNAJC25. Synthetic peptide located within the following region: RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
Dnajc25 Rabbit Polyclonal Antibody
TA356402

USD 539.00

5 Days

Dnajc25 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated