Antibodies

Jump to Filters
View as table Download
DCAF4L2 (N-term) Rabbit Polyclonal Antibody
AP54536PU-N

USD 580.00

2 Weeks

DCAF4L2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human WDR21C
DCAF4L2 Rabbit Polyclonal Antibody
TA335387

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCAF4L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DCAF4L2 Antibody is: synthetic peptide directed towards the N-terminal region of Human DCAF4L2. Synthetic peptide located within the following region: MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELR