Antibodies

Jump to Filters
View as table Download
DC SIGN (CD209) Rabbit Polyclonal Antibody
TA306058

USD 570.00

5 Days

Rabbit Polyclonal DC-SIGN Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-DIGN .
DC SIGN (CD209) Mouse Monoclonal Antibody [Clone ID: 5D7]
TA319909

USD 645.00

5 Days

Mouse DC-SIGN Monoclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
DC SIGN (CD209) Rabbit Polyclonal Antibody
TA306059

USD 570.00

5 Days

Rabbit Polyclonal DC-SIGN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-SIGN .
DC SIGN (CD209) Rabbit Polyclonal Antibody
TA329455

USD 539.00

5 Days

Rabbit Polyclonal anti-CD209 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD209 antibody: synthetic peptide directed towards the N terminal of human CD209. Synthetic peptide located within the following region: AGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQL
DC SIGN (CD209) Rabbit Polyclonal Antibody
TA329456

USD 539.00

5 Days

Rabbit Polyclonal anti-CD209 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CD209 antibody is: synthetic peptide directed towards the C-terminal region of Human CD209. Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA