CYTH2 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CYTH2 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYTH2 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CYTH2 mouse monoclonal antibody,clone OTI4D9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
CYTH2 mouse monoclonal antibody,clone OTI4D9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Cytohesin 2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CYTH2 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Cytohesin 2 (CYTH2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 35-64 amino acids from the N-terminal region of Human Cytohesin 2 (N-term). |
Goat Polyclonal Antibody against PSCD2
Applications | WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EDGVYEPPDLTP-C, from the N Terminus of the protein sequence according to NP_004219.2; NP_059431.1. |
Rabbit Polyclonal Anti-CYTH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYTH2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CYTH2. Synthetic peptide located within the following region: GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPN |