Germany
Japan
United Kingdom
China
CSTF3 goat polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001317.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CSTF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTF3 antibody: synthetic peptide directed towards the middle region of human CSTF3. Synthetic peptide located within the following region: FEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSK |
Rabbit Polyclonal Anti-CSTF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTF3 antibody: synthetic peptide directed towards the N terminal of human CSTF3. Synthetic peptide located within the following region: YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE |
CSTF3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSTF3 |
Active filters
Target Symbol
- CSTF3