Antibodies

View as table Download

CR1L rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CR1L

CR1L rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CR1L

Cr1l mouse monoclonal antibody, clone 512, Aff - Purified

Applications FC, IHC
Reactivities Rat
Conjugation Unconjugated

Cr1l mouse monoclonal antibody, clone TLD-1C11, FITC

Applications ELISA, FN, IF, IHC, WB
Reactivities Rat
Conjugation FITC

Cr1l mouse monoclonal antibody, clone TLD-1C11, Purified

Applications ELISA, FN, IF, IHC, WB
Reactivities Rat
Conjugation Unconjugated

Cr1l mouse monoclonal antibody, clone 512, Biotin

Applications FC, IHC
Reactivities Rat
Conjugation Biotin

Cr1l mouse monoclonal antibody, clone 512, Purified

Applications FC, IHC
Reactivities Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CR1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the middle region of Human CR1L. Synthetic peptide located within the following region: ALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYD

Rabbit Polyclonal Anti-CR1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the N-terminal region of Human CR1L. Synthetic peptide located within the following region: IGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGM

Cr1l mouse monoclonal antibody, clone 512, FITC

Applications FC, IHC
Reactivities Rat
Conjugation FITC

Cr1l rat monoclonal antibody, clone 8A/E6, Purified

Applications ELISA
Reactivities Mouse
Conjugation Unconjugated