Antibodies

Jump to Filters
View as table Download
Collagen XV (COL15A1) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF507124

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) COL15A1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Collagen XV (COL15A1) Rabbit Polyclonal Antibody
TA342547

USD 539.00

5 Days

Rabbit Polyclonal Anti-Col15a1 Antibody

Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Col15a1 antibody is: synthetic peptide directed towards the middle region of Rat Col15a1. Synthetic peptide located within the following region: ASGQPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKNGEVGIPGAMGPP