Antibodies

View as table Download

Rabbit Polyclonal Anti-CMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA

CMA1 (96-110) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human CMA1 / Mast Cell Chymase (NP_001827.1)

Goat Anti-CMA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QFRHPKYNTSTLHHD, from the internal region of the protein sequence according to NP_001827.1.

Mast Cell Chymase (CMA1) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 81-247 of human Mast Cell Chymase (Mast Cell Chymase (CMA1)) (NP_001827.1).
Modifications Unmodified