CLASP2 rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1005~1034 amino acids from the Y1019 region of human CLASP2 |
CLASP2 rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1005~1034 amino acids from the Y1019 region of human CLASP2 |
CLASP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CLASP2. |
CLASP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLASP2 |
CLASP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLASP2 |
Rabbit Polyclonal Anti-CLASP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CLASP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CLASP2. Synthetic peptide located within the following region: AGRVSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRRGRLGA |
Rabbit Polyclonal Anti-CLASP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLASP2 antibody is: synthetic peptide directed towards the C-terminal region of Human CLASP2. Synthetic peptide located within the following region: VAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS |
CLASP2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human CLASP2 |
CLASP2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-400 of human CLASP2 (NP_001193973.1). |
Modifications | Unmodified |
Anti-CLASP2 (N-terminus) Antibody
Applications | ICC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |