Antibodies

Jump to Filters
View as table Download
CHORDC1 Rabbit Polyclonal Antibody
TA336847

USD 550.00

2 Weeks

Rabbit Polyclonal CHORDC1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human CHORDC1 protein (between residues 100-250) [UniProt Q9UHD1]
CHORDC1 Rabbit Polyclonal Antibody
TA306916

USD 570.00

5 Days

Rabbit Polyclonal CHORDC1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CHORDC1 antibody was raised against a 21 amino acid peptide near the amino terminus of human CHORDC1.
CHORDC1 Rabbit Polyclonal Antibody
TA334433

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHORDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHORDC1 antibody: synthetic peptide directed towards the middle region of human CHORDC1. Synthetic peptide located within the following region: SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
CHORDC1 Rabbit Polyclonal Antibody
TA357193

USD 539.00

5 Days

CHORDC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRD1
CHORDC1 Rabbit Polyclonal Antibody
TA361688

USD 539.00

5 Days

CHORDC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHORDC1
CHORDC1 Rabbit Polyclonal Antibody
TA374757

USD 365.00

3 Weeks

CHORDC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human CHORDC1 (NP_036256.2).