Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-C21orf2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C21orf2 antibody: synthetic peptide directed towards the N terminal of human C21orf2. Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS |
Rabbit Polyclonal Anti-C21orf2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C21orf2 antibody is: synthetic peptide directed towards the C-terminal region of Human C21orf2. Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL |
Active filters
Target Symbol
- CFAP410