CFAP410 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CFAP410 |
CFAP410 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CFAP410 |
CFAP410 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 172-202 amino acids from the C-terminal region of human CU002 |
Rabbit Polyclonal Anti-C21orf2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C21orf2 antibody: synthetic peptide directed towards the N terminal of human C21orf2. Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS |
Rabbit Polyclonal Anti-C21orf2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C21orf2 antibody is: synthetic peptide directed towards the C-terminal region of Human C21orf2. Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL |