Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDX4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDX4 antibody: synthetic peptide directed towards the C terminal of human CDX4. Synthetic peptide located within the following region: KKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVS |
Rabbit Polyclonal anti-CDX4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDX4 antibody: synthetic peptide directed towards the middle region of human CDX4. Synthetic peptide located within the following region: TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERK |
Rabbit Polyclonal Anti-Cdx4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cdx4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENTGGSVQSDSGS |
CDX4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDX4 |
Active filters
Target Symbol
- CDX4