Antibodies

View as table Download

CDH19 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CDH19

Rabbit polyclonal anti-CDH19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDH19.

Rabbit Polyclonal Anti-CDH19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDH19 antibody is: synthetic peptide directed towards the middle region of Human CDH19. Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG