Antibodies

View as table Download

Rabbit Polyclonal Anti-CBX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX6 antibody: synthetic peptide directed towards the N terminal of human CBX6. Synthetic peptide located within the following region: FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK

Rabbit polyclonal anti-CBX6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBX6.

Rabbit Polyclonal Anti-CBX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CBX6

CBX6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3).
Modifications Unmodified

Rabbit Polyclonal Anti-CBX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX6 antibody: synthetic peptide directed towards the C terminal of human CBX6. Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

Rabbit Polyclonal Anti-CBX6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX6 Antibody: A synthesized peptide derived from human CBX6