Antibodies

View as table Download

CAPZA3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CAPZA3

Rabbit Polyclonal Anti-CAPZA3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CAPZA3

Rabbit Polyclonal Anti-CAPZA3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPZA3 antibody: synthetic peptide directed towards the N terminal of human CAPZA3. Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Capza3 (N-term) guinea pig polyclonal antibody, Serum

Applications WB
Reactivities Bovine, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic N-terminal domain (aa 2-17: SLSVLSRKEKEKVIHR-C) of mouse F-actin α3 subunit, coupled to KLH (for sequence data see below ref. Tanaka et al., 1994)