CAPZA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAPZA3 |
CAPZA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAPZA3 |
Rabbit Polyclonal Anti-CAPZA3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAPZA3 |
Rabbit Polyclonal Anti-CAPZA3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPZA3 antibody: synthetic peptide directed towards the N terminal of human CAPZA3. Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC |
Capza3 (N-term) guinea pig polyclonal antibody, Serum
Applications | WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic N-terminal domain (aa 2-17: SLSVLSRKEKEKVIHR-C) of mouse F-actin α3 subunit, coupled to KLH (for sequence data see below ref. Tanaka et al., 1994) |