Antibodies

View as table Download

CYB5R4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CYB5R4

Goat Anti-Cyb5r4 (mouse aa444-458) Antibody

Applications WB
Reactivities Rat (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence RCQLEKLALREKRFD, from the internal region of the protein sequence according to NP_077157.2.

Rabbit Polyclonal Anti-CYB5R4 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyb5r4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL