CYB5R4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYB5R4 |
CYB5R4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYB5R4 |
Goat Anti-Cyb5r4 (mouse aa444-458) Antibody
Applications | WB |
Reactivities | Rat (Expected from sequence similarity: Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RCQLEKLALREKRFD, from the internal region of the protein sequence according to NP_077157.2. |
Rabbit Polyclonal Anti-CYB5R4 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyb5r4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL |