Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CWF19L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CWF19L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CWF19L1. Synthetic peptide located within the following region: FPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDF |
Rabbit Polyclonal Anti-CWF19L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CWF19L1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CWF19L1. Synthetic peptide located within the following region: ENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSS |
Active filters
Target Symbol
- CWF19L1