CWF19L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CWF19L1 |
CWF19L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CWF19L1 |
CWF19L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CWF19L1 |
Rabbit Polyclonal Anti-CWF19L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CWF19L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CWF19L1. Synthetic peptide located within the following region: FPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDF |
Rabbit Polyclonal Anti-CWF19L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CWF19L1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CWF19L1. Synthetic peptide located within the following region: ENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSS |