Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 9 of 9 results

(reset)

CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]

TA500951

USD 447.00

In Stock

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]

CF500951

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

CUG BP1 (CELF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]

TA500951AM

USD 509.00

2 Weeks

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

CUG BP1 (CELF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B8]

TA500951BM

USD 509.00

2 Weeks

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]

TA500951S

USD 200.00

In Stock

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: 3B1]

TA301501

USD 605.00

5 Days

Mouse Monoclonal Antibody against CUG-BP1 (3B1)

Applications	FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Bovine, Porcine, Rabbit
Conjugation	Unconjugated

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CUG BP1 (CELF1) (+CUGBP2) Rabbit Polyclonal Antibody

AP20451PU-N

USD 465.00

3 Weeks

CUG BP1 (CELF1) (+CUGBP2) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 62-115 of Human CUG-BP1/2.

1 / 2

2 / 2

Previous Next

CUG BP1 (CELF1) Rabbit Polyclonal Antibody

TA312319

USD 380.00

In Stock

Rabbit polyclonal anti-CELF-1 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human CELF-1.

CUG BP1 (CELF1) Rabbit Polyclonal Antibody

TA345754

USD 539.00

5 Days

Rabbit Polyclonal Anti-CUGBP1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP

1 - 9 of 9 results