Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against CUG-BP1 (3B1)
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
CUG BP1 (CELF1) (+CUGBP2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 62-115 of Human CUG-BP1/2. |
Rabbit polyclonal anti-CELF-1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CELF-1. |
Rabbit Polyclonal Anti-CUGBP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP |