Rabbit Polyclonal Anti-CRIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
CRIP2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 178-208 amino acids from the C-terminal region of human CRIP2 |
Rabbit Polyclonal Anti-CRIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the N terminal of human CRIP2. Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP |
CRIP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human CRIP2 (NP_001303.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
