CHST11 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHST11 |
CHST11 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHST11 |
CHST11 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHST11 |
Rabbit Polyclonal Anti-Chst11 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |
Rabbit Polyclonal Anti-Chst11 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS |
CHST11 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHST11 |
CHST11 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 38-352 of human CHST11 (NP_060883.1). |
Modifications | Unmodified |