Antibodies

View as table Download

Rabbit polyclonal anti-CHML antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHML.

Rabbit Polyclonal Anti-CHML Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHML antibody: synthetic peptide directed towards the N terminal of human CHML. Synthetic peptide located within the following region: NPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTD