Rabbit polyclonal FOXN3 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXN3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-408 amino acids from the C-terminal region of human FOXN3. |
Rabbit Polyclonal Anti-FOXN3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXN3 antibody: synthetic peptide directed towards the middle region of human FOXN3. Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV |
Rabbit Polyclonal Anti-FOXN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXN3 antibody: synthetic peptide directed towards the middle region of human FOXN3. Synthetic peptide located within the following region: HKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIR |
Rabbit Polyclonal Anti-CHES1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1. Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL |
Germany
Japan
United Kingdom
China
