Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDRT15L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDRT15L2 antibody is: synthetic peptide directed towards the N-terminal region of Human CDRT15L2. Synthetic peptide located within the following region: QTHAPGPYADIAALAAPAVEPKPAWEEPPPERALEVEGAPAKDQPSQELP |
Rabbit Polyclonal Anti-CDRT15L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDRT15L2 antibody is: synthetic peptide directed towards the N-terminal region of Human CDRT15L2. Synthetic peptide located within the following region: RLIPHPRRLWPFVRRRTQVPQDSPGQALAGQATPEIPSGLPLHIVLVQEE |
Active filters
Target Symbol
- CDRT15L2