Antibodies

View as table Download

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDR2

CDR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDR2

Rabbit Polyclonal CDR2 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850]

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2. Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ