Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3. Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF |
Rabbit polyclonal antibody to Cdk3 (cyclin-dependent kinase 3)
| Applications | WB |
| Reactivities | Human (Predicted: Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 238 of Cdk3 (Uniprot ID#Q00526) |
CDK3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDK3 |
Rabbit anti Cdk3 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CDK3