CCDC50 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from C-term domain of human CCD50 |
CCDC50 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from C-term domain of human CCD50 |
Goat Anti-Ymer / CCDC50 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CFSKSESSHKGFHYK, from the internal region of the protein sequence according to NP_848018.1; NP_777568.1. |
Rabbit Polyclonal Anti-CCDC50 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV |
Rabbit Polyclonal Anti-CCDC50 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: KAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPP |
CCDC50 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1). |
Modifications | Unmodified |