Germany
Japan
United Kingdom
China
Cav gamma 4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Peptide of L-type Ca++ CP γ4 |
Antibodies
View as table Download
CACNG4 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the rat calcium channel gamma4 subunit conjugated to KLH |
CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4 |
Rabbit Polyclonal Anti-CaVGamma4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EKNKELRFKTKRE, corresponding to amino acid residues 208-220 of rat Cav?4. Intracellular, C-terminus. |
Rabbit polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
CACNG4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CACNG4 |
Active filters
Target Symbol
- CACNG4