Rabbit polyclonal anti-CA5A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA5A. |
Rabbit polyclonal anti-CA5A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA5A. |
Rabbit Polyclonal Anti-CA5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CA5A antibody: synthetic peptide directed towards the C terminal of human CA5A. Synthetic peptide located within the following region: PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS |
Rabbit Polyclonal Anti-CA5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CA5A antibody: synthetic peptide directed towards the C terminal of human CA5A. Synthetic peptide located within the following region: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY |
CA5A rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CA5A |
CA5A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-305 of human CA5A (NP_001730.1). |
Modifications | Unmodified |