Antibodies

Jump to Filters
View as table Download
C6orf150 (MB21D1) Rabbit Polyclonal Antibody
TA340293

USD 539.00

In Stock

Rabbit Polyclonal Anti-MB21D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MB21D1 antibody: synthetic peptide directed towards the middle region of human MB21D1. Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
C6orf150 (MB21D1) (Center) Rabbit Polyclonal Antibody
AP50874PU-N

USD 580.00

2 Weeks

C6orf150 (MB21D1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 266-295 amino acids from the Central region of Human CF150