Antibodies

Jump to Filters
View as table Download
C3orf54 (FAM212A) Rabbit Polyclonal Antibody
TA306893

USD 570.00

5 Days

Rabbit Polyclonal INCA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen INCA1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human INCA1.
C3orf54 (FAM212A) Rabbit Polyclonal Antibody
TA334892

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAM212A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM212A antibody is: synthetic peptide directed towards the middle region of Human FAM212A. Synthetic peptide located within the following region: RAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVL