Rabbit Polyclonal Anti-GUCD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C22orf13 Antibody is: synthetic peptide directed towards the C-terminal region of Human C22orf13. Synthetic peptide located within the following region: GHFIVLRGYNRATGCIFYNNPAYADPGMCSTSISNFEEARTSYGTDEDIL |
Rabbit Polyclonal Anti-GUCD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C22orf13 Antibody is: synthetic peptide directed towards the middle region of Human C22orf13. Synthetic peptide located within the following region: RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT |
Germany
Japan
United Kingdom
China