RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPRD1B mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
C20orf77 (RPRD1B) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 261~290 amino acids from the C-terminal region of Human RPR1B. |
Rabbit Polyclonal Anti-RPRD1B Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RPRD1B antibody: synthetic peptide directed towards the middle region of human RPRD1B. Synthetic peptide located within the following region: KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS |
Rabbit Polyclonal Anti-RPRD1B Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Rprd1b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rprd1b. Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY |