Rabbit Polyclonal Anti-GID4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GID4Antibody: synthetic peptide directed towards the C terminal of human C17orf39. Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR |
Rabbit Polyclonal Anti-GID4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GID4Antibody: synthetic peptide directed towards the C terminal of human C17orf39. Synthetic peptide located within the following region: WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL |
Germany
Japan
United Kingdom
China