Rabbit Polyclonal Fat Free Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fat Free antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human Fat Free. |
Rabbit Polyclonal Fat Free Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fat Free antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human Fat Free. |
Rabbit polyclonal antibody to C11orf2 (chromosome 11 open reading frame2)
Applications | WB |
Reactivities | Human (Predicted: Zebrafish) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 489 and 721 of C11orf2 (Uniprot ID#Q9UID3) |
Rabbit Polyclonal Anti-VPS51 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C11orf2 Antibody is: synthetic peptide directed towards the C-terminal region of Human C11orf2. Synthetic peptide located within the following region: EEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKL |