Antibodies

Jump to Filters
View as table Download
BRI3BP Rabbit Polyclonal Antibody
TA367612

USD 380.00

4 Weeks

BRI3BP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRI3BP
BRI3BP Rabbit Polyclonal Antibody
TA371845

USD 380.00

4 Weeks

BRI3BP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRI3BP
BRI3BP Rabbit Polyclonal Antibody
TA316127

USD 380.00

4 Weeks

Rabbit polyclonal anti-BRI3B antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BRI3B.
BRI3BP Rabbit Polyclonal Antibody
TA342090

USD 539.00

5 Days

Rabbit Polyclonal Anti-BRI3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRI3BP antibody: synthetic peptide directed towards the C terminal of human BRI3BP. Synthetic peptide located within the following region: GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK