ZBTB44 mouse monoclonal antibody,clone OTI7F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ZBTB44 mouse monoclonal antibody,clone OTI7F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZBTB44 mouse monoclonal antibody,clone OTI7F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ZBTB44 mouse monoclonal antibody,clone OTI7F12, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ZBTB44 mouse monoclonal antibody,clone OTI7F12, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-ZBTB44 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BTBD15 antibody: synthetic peptide directed towards the C terminal of human BTBD15. Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV |
Rabbit Polyclonal Anti-ZBTB44 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44. Synthetic peptide located within the following region: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRNQPVDSSLAFP |
ZBTB44 mouse monoclonal antibody,clone OTI7F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |