Antibodies

Jump to Filters
View as table Download
BEND6 (C-term) Rabbit Polyclonal Antibody
AP50366PU-N

USD 580.00

2 Weeks

BEND6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 225-254 amino acids from the C-terminal region of human BEND6
Bend6 Rabbit Polyclonal Antibody
TA329781

USD 539.00

5 Days

Rabbit polyclonal Anti-Bend6 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bend6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK