Rabbit Polyclonal Anti-ABHD16A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD16Aantibody: synthetic peptide directed towards the N terminal of human BAT5. Synthetic peptide located within the following region: VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK |
Rabbit Polyclonal Anti-ABHD16A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD16Aantibody: synthetic peptide directed towards the middle region of human BAT5. Synthetic peptide located within the following region: RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL |
Germany
Japan
United Kingdom
China