Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ATL3 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-440 of human ATL3 (NP_056274.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-ATL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATL3 antibody is: synthetic peptide directed towards the middle region of Human ATL3. Synthetic peptide located within the following region: ESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAV |
Rabbit Polyclonal Anti-DKFZP564J0863 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863. Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA |
Rabbit Polyclonal Anti-DKFZP564J0863 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863. Synthetic peptide located within the following region: IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSF |
ATL3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATL3 |
Active filters
Target Symbol
- ATL3