Goat Anti-APOL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ELTQIYQRLNPCHTH, from the C Terminus of the protein sequence according to NP_663615.1, NP_055164.1, NP_663616.1. |
Goat Anti-APOL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ELTQIYQRLNPCHTH, from the C Terminus of the protein sequence according to NP_663615.1, NP_055164.1, NP_663616.1. |
Rabbit Polyclonal Anti-APOL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the middle region of Human APOL3. Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC |
Rabbit Polyclonal Anti-APOL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the N-terminal region of Human APOL3. Synthetic peptide located within the following region: DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI |