Antibodies

View as table Download

Rabbit anti-ALKBH3 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ALKBH3

Rabbit Polyclonal Anti-ALKBH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALKBH3 Antibody: synthetic peptide directed towards the middle region of human ALKBH3. Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS